Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003229 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003229, RRID:AB_2246696
- Product name
- Anti-FAM117B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVS
ILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIA
VASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEE
AE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
Asplund A, Gry Björklund M, Sundquist C, Strömberg S, Edlund K, Östman A, Nilsson P, Pontén F, Lundeberg J
British Journal of Dermatology 2008 March;158(3):527-538
British Journal of Dermatology 2008 March;158(3):527-538
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN