Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023899 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023899, RRID:AB_1845813
- Product name
- Anti-SAXO1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTP
KEMGRCLASYPEPPGYTFEEVDALGHRIYKPVSQA
GSQQSSHLSVDDSENPNQRELEVLA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Human FAM154A (SAXO1) is a microtubule-stabilizing protein specific to cilia and related structures
Dacheux D, Roger B, Bosc C, Landrein N, Roche E, Chansel L, Trian T, Andrieux A, Papaxanthos-Roche A, Marthan R, Robinson D, Bonhivers M
Journal of Cell Science 2015 March;128(7):1294-1307
Journal of Cell Science 2015 March;128(7):1294-1307
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406974)
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and FAM154A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406974).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and endometrium tissues using Anti-SAXO1 antibody. Corresponding SAXO1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN