Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21339 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21339, RRID:AB_10966003
- Product name
- FAM29A polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant FAM29A.
- Antigen sequence
HHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQ
DCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKM
EPYDDHSNMEEKIQKVRSLWASVN- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251MG with FAM29A polyclonal antibody (Cat # PAB21339) at 1-4 ug/mL dilution shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus with FAM29A polyclonal antibody (Cat # PAB21339) shows strong positivity in squamous epithelial cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)