Explore
Validate
LearnHPA002353
antibody from Atlas Antibodies
Targeting: PUM3
HA-8, hPUF-A, KIAA0020, PEN, Puf-A, PUF6, XTP5
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002353 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002353, RRID:AB_1852266
- Product name
- Anti-PUM3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIA
SLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQD
KKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGA
IILSSLLQSCDLEVANKVKAALKSLIPTLEKTKST
SKGI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and KIAA0020 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414965).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HDLM-2.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows nuclear membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows weak to moderate positivity in nucleoli in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows weak to moderate positivity in nucleoli in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows weak to moderate positivity in nucleoli in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows weak to moderate positivity in nucleoli in glandular cells.
- Sample type
- HUMAN
