H00001808-M01

DPYSL2 antibody from Abnova Corporation
CRMP2, DHPRP2, DRP-2, DRP2

Antibody data

Product number
H00001808-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001808-M01, RRID:AB_1674809
Product name
DPYSL2 monoclonal antibody (M01), clone 1F11
Provider product page
Abnova Corporation - H00001808-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DPYSL2.
Antigen sequence
PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVC
EVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGF
SLSGAQIDDNIPRRTTQRIVAPPGGRANITSL
Isotype
IgG
Antibody clone number
1F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -