ARP50323_P050

antibody from Aviva Systems Biology

Targeting: ZNF783 DKFZp667J212

Antibody data

Submit

Validation data

Product number: ARP50323_P050 - Provider product page
Provider: Aviva Systems Biology
Proper citation: Aviva Systems Biology Cat#ARP50323_P050, RRID:AB_10568991
Product name: Anti-KIAA0020
Antibody type: Polyclonal
Antigen: Synthetic peptide
Description: This is a rabbit polyclonal antibody against KIAA0020. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment; please inquire (info@avivasysbio.com).
Reactivity: Human, Bovine, Canine
Host: Rabbit
Antigen sequence: Antigen corresponding to the follow ing peptide sequence: EVKGKKQFTGKST KTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVT SR
Isotype: IgG
Vial size: 50ug
Concentration: 1 mg/ml
Handling: Add 50 μl of distilled water. Final antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage; store at -20°C. Avoid repeat freeze-thaw cycles.

ZNF783 protein structure - ARP50323_P050 shown in red.