HPA071600

antibody from Atlas Antibodies

Targeting: CCNF FBX1, FBXO1

Antibody data

Submit

Validation data

Product number: HPA071600 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA071600, RRID:AB_2686424
Product name: Anti-CCNF
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQ ESSDEEACPEDKGPQDPQALALDTQIPATPGPKPL VR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CCNF protein structure - HPA071600 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and pancreas tissues using Anti-CCNF antibody. Corresponding CCNF RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human liver, lymph node, pancreas and skin using Anti-CCNF antibody HPA071600 (A) shows similar protein distribution across tissues to independent antibody HPA070495 (B).
Antibody #2 product nr: HPA070495
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in a subset of germinal and non-germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CCNF antibody HPA071600.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CCNF antibody HPA071600.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-CCNF antibody HPA071600.
Sample type: HUMAN