Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28572 - Provider product page
- Provider
- Abnova Corporation
- Product name
- PSMD14 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant PSMD14.
- Antigen sequence
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLML
GEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQA
KMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDIN
TQQSFEALSERAVAVVVDPIQSVKGKVVIDA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: U-251 MG, lane 3: Liver and lane 4: Tonsil using PSMD14 polyclonal antibody (Cat # PAB28572).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: NIH-3T3 and lane 2: NBT-II cell lysates using PSMD14 polyclonal antibody (Cat # PAB28572).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of U-2 OS cell line with PSMD14 polyclonal antibody (Cat # PAB28572) shows positivity in nucleus but not nucleoli and vesicles. Fixation/Permeabilization: PFA/Triton X-102
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human hippocampus with PSMD14 polyclonal antibody (Cat # PAB28572) shows strong nuclear positivity in neuronal cells. Retrieval method: HIER pH6
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)