HPA001908

antibody from Atlas Antibodies

Targeting: LAMC1 LAMB2

Antibody data

Submit

Validation data

Product number: HPA001908 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001908, RRID:AB_1079229
Product name: Anti-LAMC1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ECREGFVGNRCDQCEENYFYNRSWPGCQECPACYR LVKDKVADHRVKLQELESLIANLGTGDEMVTDQAF EDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRV NNTLSSQISRLQNIRNTIEETGNLAEQARAHVENT ERLIEIASR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LAMC1 protein structure - HPA001908 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and tonsil tissues using Anti-LAMC1 antibody. Corresponding LAMC1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, placenta and tonsil using Anti-LAMC1 antibody HPA001908 (A) shows similar protein distribution across tissues to independent antibody HPA001909 (B).
Antibody #2 product nr: HPA001909
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-LAMC1 antibody HPA001908.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-LAMC1 antibody HPA001908.
Sample type: HUMAN