Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28594 - Provider product page
- Provider
- Abnova Corporation
- Product name
- LCN2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant LCN2.
- Antigen sequence
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVG
LAGNAILREDKDPQKMYATIYELKEDKSYNVTSVL
FRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTS
YLVRVVSTNYNQHAMVFFKKVSQNREYFKITL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Human cell line RT-4 with LCN2 polyclonal antibody (Cat#PAB28594).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with LCN2 polyclonal antibody (Cat#PAB28594) at 4 ug/ml shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen with LCN2 polyclonal antibody (Cat#PAB28594) shows strong cytoplasmic positivity in subsets of cells in the red pulp at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)