Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023873 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023873, RRID:AB_1845834
- Product name
- Anti-C9orf72
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRI
WMHKERQENVQKIILEGTERMEDQGQSIIPMLTGE
VIPVMELLSSMKSHSVPEEI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Antisense proline-arginine RAN dipeptides linked to C9ORF72-ALS/FTD form toxic nuclear aggregates that initiate in vitro and in vivo neuronal death.
Distinct clinical and pathological characteristics of frontotemporal dementia associated with C9ORF72 mutations.
Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion.
Dystrophic neurites express C9orf72 in Alzheimer's disease brains.
Wen X, Tan W, Westergard T, Krishnamurthy K, Markandaiah SS, Shi Y, Lin S, Shneider NA, Monaghan J, Pandey UB, Pasinelli P, Ichida JK, Trotti D
Neuron 2014 Dec 17;84(6):1213-25
Neuron 2014 Dec 17;84(6):1213-25
Distinct clinical and pathological characteristics of frontotemporal dementia associated with C9ORF72 mutations.
Snowden JS, Rollinson S, Thompson JC, Harris JM, Stopford CL, Richardson AM, Jones M, Gerhard A, Davidson YS, Robinson A, Gibbons L, Hu Q, DuPlessis D, Neary D, Mann DM, Pickering-Brown SM
Brain : a journal of neurology 2012 Mar;135(Pt 3):693-708
Brain : a journal of neurology 2012 Mar;135(Pt 3):693-708
Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion.
Brettschneider J, Van Deerlin VM, Robinson JL, Kwong L, Lee EB, Ali YO, Safren N, Monteiro MJ, Toledo JB, Elman L, McCluskey L, Irwin DJ, Grossman M, Molina-Porcel L, Lee VM, Trojanowski JQ
Acta neuropathologica 2012 Jun;123(6):825-39
Acta neuropathologica 2012 Jun;123(6):825-39
Dystrophic neurites express C9orf72 in Alzheimer's disease brains.
Satoh J, Tabunoki H, Ishida T, Saito Y, Arima K
Alzheimer's research & therapy 2012 Aug 16;4(4):33
Alzheimer's research & therapy 2012 Aug 16;4(4):33
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN
