Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021527 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021527, RRID:AB_1853626
- Product name
- Anti-MCM3AP
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGR
TIQDVFKSNKEVGRLGNKEAKKETGFVESAESDHM
AIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLR
GTPARQSNRSESTDSLGGLSPSEVTAIQCKNIPDY
L- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy.
Singh SK, Maeda K, Eid MM, Almofty SA, Ono M, Pham P, Goodman MF, Sakaguchi N
Nature communications 2013;4:1830
Nature communications 2013;4:1830
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.