Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000048-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000048-M01, RRID:AB_464260
- Product name
- ACO1 monoclonal antibody (M01), clone 2C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACO1.
- Antigen sequence
RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVI
PLEYLPGENADALGLTGQERYTIIIPENLKPQMKV
QVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMI
RKMAK- Isotype
- IgG
- Antibody clone number
- 2C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references IF/TA-related metabolic changes--proteome analysis of rat renal allografts.
Reuter S, Reiermann S, Wörner R, Schröter R, Edemir B, Buck F, Henning S, Peter-Katalinic J, Vollenbröker B, Amann K, Pavenstädt H, Schlatter E, Gabriëls G
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2010 Aug;25(8):2492-501
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2010 Aug;25(8):2492-501
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ACO1 transfected lysate using anti-ACO1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ACO1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol