Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503536 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Immature Colon Carcinoma Transcript 1 (ICT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ICT1 antibody: synthetic peptide directed towards the middle region of human ICT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
AEWIAEPVRQKIAITHKNKINRLGELILTSESSRY
QFRNL ADCLQKIRDM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of mRNAs that show modulated expression during colon carcinoma cell differentiation.
van Belzen N, Diesveld MP, van der Made AC, Nozawa Y, Dinjens WN, Vlietstra R, Trapman J, Bosman FT
European journal of biochemistry / FEBS 1995 Dec 15;234(3):843-8
European journal of biochemistry / FEBS 1995 Dec 15;234(3):843-8
No comments: Submit comment
No validations: Submit validation data