Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005087-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005087-M01, RRID:AB_606725
- Product name
- PBX1 monoclonal antibody (M01), clone 4A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PBX1.
- Antigen sequence
MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEI
LNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSN
WFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVS
AHGS- Isotype
- IgG
- Antibody clone number
- 4A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The Histone Variant MacroH2A1.2 Is Necessary for the Activation of Muscle Enhancers and Recruitment of the Transcription Factor Pbx1.
Differential epigenetic reprogramming in response to specific endocrine therapies promotes cholesterol biosynthesis and cellular invasion.
Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
PBX1 genomic pioneer function drives ERα signaling underlying progression in breast cancer.
Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
Dell'Orso S, Wang AH, Shih HY, Saso K, Berghella L, Gutierrez-Cruz G, Ladurner AG, O'Shea JJ, Sartorelli V, Zare H
Cell reports 2016 Feb 9;14(5):1156-68
Cell reports 2016 Feb 9;14(5):1156-68
Differential epigenetic reprogramming in response to specific endocrine therapies promotes cholesterol biosynthesis and cellular invasion.
Nguyen VT, Barozzi I, Faronato M, Lombardo Y, Steel JH, Patel N, Darbre P, Castellano L, Győrffy B, Woodley L, Meira A, Patten DK, Vircillo V, Periyasamy M, Ali S, Frige G, Minucci S, Coombes RC, Magnani L
Nature communications 2015 Nov 27;6:10044
Nature communications 2015 Nov 27;6:10044
Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
Bjerke GA, Hyman-Walsh C, Wotton D
Molecular and cellular biology 2011 Sep;31(18):3723-33
Molecular and cellular biology 2011 Sep;31(18):3723-33
PBX1 genomic pioneer function drives ERα signaling underlying progression in breast cancer.
Magnani L, Ballantyne EB, Zhang X, Lupien M
PLoS genetics 2011 Nov;7(11):e1002368
PLoS genetics 2011 Nov;7(11):e1002368
Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
Cheung CL, Chan BY, Chan V, Ikegawa S, Kou I, Ngai H, Smith D, Luk KD, Huang QY, Mori S, Sham PC, Kung AW
Human molecular genetics 2009 Feb 15;18(4):679-87
Human molecular genetics 2009 Feb 15;18(4):679-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PBX1 monoclonal antibody (M01), clone 4A2 Western Blot analysis of PBX1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PBX1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PBX1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol