Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00030001-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00030001-A01, RRID:AB_489686
- Product name
- ERO1L polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ERO1L.
- Antigen sequence
DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEA
NNLIEECEQAERLGAVDESLSEETQKAVLQWTKHD
DSSDNFCEADDIQSPEAEY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of a domain within peroxisome proliferator-activated receptor gamma regulating expression of a group of genes containing fibroblast growth factor 21 that are selectively repressed by SIRT1 in adipocytes.
Adiponectin secretion is regulated by SIRT1 and the endoplasmic reticulum oxidoreductase Ero1-L alpha.
Wang H, Qiang L, Farmer SR
Molecular and cellular biology 2008 Jan;28(1):188-200
Molecular and cellular biology 2008 Jan;28(1):188-200
Adiponectin secretion is regulated by SIRT1 and the endoplasmic reticulum oxidoreductase Ero1-L alpha.
Qiang L, Wang H, Farmer SR
Molecular and cellular biology 2007 Jul;27(13):4698-707
Molecular and cellular biology 2007 Jul;27(13):4698-707
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1. Western Blot analysis of ERO1L expression in Raw 264.7.