WH0006161M1

RPL32 antibody from MilliporeSigma / Merck KGaA
L32
ELISA
Recommended by provider

Antibody data

Product number
WH0006161M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0006161M1, RRID:AB_1843419
Product name
Monoclonal Anti-RPL32 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0006161M1
Antibody type
Monoclonal
Antigen
RPL32 (NP_000985, a.a. 33-133) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTK
HMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHN
VSSKNRKAIVERAAQLAIRVTNPNARLRSE* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -