Antibody data

Product number
ABIN183902
Provider
antibodies-online
Product name
anti-Ribosomal Protein L32 (RPL32) antibody
Provider product page
antibodies-online - ABIN183902
Antibody type
Polyclonal
Antigen
The immunogen for anti-RPL32 antibody: synthetic peptide directed towards the N terminal of human RPL32
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus
Host
Rabbit
Antigen sequence
AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWR
KPRGI DNRVRRRFKG
Vial size
0.1 mg
Provider Type Product Number
- No reagents -