AV40219

RPL32 antibody from MilliporeSigma / Merck KGaA
L32
No application information provided.

Antibody data

Product number
AV40219
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV40219, RRID:AB_1856442
Product name
Anti-RPL32 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV40219
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human RPL32 with an internal ID of P22063
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWR
KPRGIDNRVRRRFKG
Storage
-20C
Provider Type Product Number
- No reagents -