Antibody data

Product number
R32008
Provider
NSJ Bioreagents
Product name
Monoamine Oxidase A Antibody / MAOA
Provider product page
NSJ Bioreagents - R32008
Antibody type
Polyclonal
Antigen
Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.
Description
Antigen affinity
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the MAOA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -