SAB1400161

MAOA antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
SAB1400161
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400161, RRID:AB_1854060
Product name
Anti-MAOA antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400161
Antibody type
Polyclonal
Antigen
MAOA (AAH08064.1, a.a. 1-527) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEY
GVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYV
GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKT
YPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPT
DAPWEAQHADKWDKMTMKELIDKICWTKTARRFAY
LFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSV
TNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVT
HVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAK
IHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFW
KKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIM
GFILARKADRLAKLHKEIRKKKICELYAKVLGSQE
ALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERA
Storage
-20C
Provider Type Product Number
- No reagents -