HPA067827

P2RX5 antibody from Atlas Antibodies
LRH-1, P2X5

Antibody data

Product number
HPA067827
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA067827, RRID:AB_2685908
Product name
Anti-P2RX5
Provider product page
Atlas Antibodies - HPA067827
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGE
AVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETS
SRPEEPFLKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -