Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019198 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019198, RRID:AB_1858118
- Product name
- Anti-TMEM43
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVG
DLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQL
VPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMK
T- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutation analysis and evaluation of the cardiac localization of TMEM43 in arrhythmogenic right ventricular cardiomyopathy
Tissue-Specific Protein Expression in Human Cells, Tissues and Organs
Christensen A, Andersen C, Tybjaerg-Hansen A, Haunso S, Svendsen J
Clinical Genetics 2011 September;80(3):256-264
Clinical Genetics 2011 September;80(3):256-264
Tissue-Specific Protein Expression in Human Cells, Tissues and Organs
Per Oksvold M
Journal of Proteomics & Bioinformatics 2010 ;03(10)
Journal of Proteomics & Bioinformatics 2010 ;03(10)
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and pancreas tissues using HPA019198 antibody. Corresponding TMEM43 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows weak positivity in nuclear membrane in glandular cells, as well as in smooth muscle cells.
- Sample type
- HUMAN