Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1105198 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Activator of Basal Transcription 1 (ABT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the middle region of human ABT1
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGS
WTFAQRPTEQELRAR- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references A novel TATA-binding protein-binding protein, ABT1, activates basal transcription and has a yeast homolog that is essential for growth.
Oda T, Kayukawa K, Hagiwara H, Yudate HT, Masuho Y, Murakami Y, Tamura TA, Muramatsu MA
Molecular and cellular biology 2000 Feb;20(4):1407-18
Molecular and cellular biology 2000 Feb;20(4):1407-18
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human heart; WB Suggested Anti-ABT1 Antibody Titration: 1.25ug/ml. Positive Control: Human heart; ABT1 antibody - middle region (AP42124PU-N) in Human heart cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human kidney; ABT1 antibody - middle region (AP42124PU-N) in Human kidney cells using Immunohistochemistry