Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [2]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004125 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004125, RRID:AB_1079312
- Product name
- Anti-MARS
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEE
ARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSS
QHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFIT
RSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYV
WFD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype.
van Meel E, Wegner DJ, Cliften P, Willing MC, White FV, Kornfeld S, Cole FS
BMC medical genetics 2013 Oct 8;14:106
BMC medical genetics 2013 Oct 8;14:106
No comments: Submit comment
Enhanced validation
Enhanced validation
- Submitted by
- klas2
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting MARS or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting MARS Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:78
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Enhanced validation
Supportive validation
- Submitted by
- 55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein MARS is shown in green. The image to the left show cells transfected with control siRNA and the image to the right show cells where MARS has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:35
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in subsets of neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse visual cortex shows cytoplasmic and axonal staining in neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse pons shows neuronal positivity in motor trigeminal nucleus.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in neuronal cell bodies.
