WH0010544M3

PROCR antibody from MilliporeSigma / Merck KGaA
CCD41, CD201, EPCR
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0010544M3
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0010544M3, RRID:AB_1840539
Product name
Monoclonal Anti-PROCR antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0010544M3
Antibody type
Monoclonal
Antigen
PROCR (AAH14451, a.a. 1-239) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISY
FRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQL
QPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERT
LAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSF
VSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTR
YELREFLEDTCVQYVQKHISAENTKGSQTSRSYTS
LVLGVLVGGFIIAGVAVGIFLCTGGRRC* (with
out GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -