HPA039461

PROCR antibody from Atlas Antibodies
CCD41, CD201, EPCR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA039461
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039461, RRID:AB_10673359
Product name
Anti-PROCR
Provider product page
Atlas Antibodies - HPA039461
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLE
GPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFH
GLVRLVHQERTLAFPLTIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -