Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021649 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021649, RRID:AB_1847913
- Product name
- Anti-DNAI1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
APHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEW
AQSKATVRPPDQLELTDAELKEEFTRILTANNPHA
PQNIVRYSFKEGTYKPIGFVNQLAVHYTQV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Activation of NOTCH1 or NOTCH3 signaling skews human airway basal cell differentiation toward a secretory pathway.
Generation of a human airway epithelium derived basal cell line with multipotent differentiation capacity.
Gomi K, Arbelaez V, Crystal RG, Walters MS
PloS one 2015;10(2):e0116507
PloS one 2015;10(2):e0116507
Generation of a human airway epithelium derived basal cell line with multipotent differentiation capacity.
Walters MS, Gomi K, Ashbridge B, Moore MA, Arbelaez V, Heldrich J, Ding BS, Rafii S, Staudt MR, Crystal RG
Respiratory research 2013 Dec 3;14(1):135
Respiratory research 2013 Dec 3;14(1):135
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and dNAI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402158).
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human fallopian tube and colon tissues using Anti-DNAI1 antibody. Corresponding DNAI1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-DNAI1 antibody HPA021649 (A) shows similar protein distribution across tissues to independent antibody HPA021843 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in cells of the seminiferus ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-DNAI1 antibody HPA021649.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-DNAI1 antibody HPA021649.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-DNAI1 antibody HPA021649.
- Sample type
- HUMAN
