Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006093-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006093-M01, RRID:AB_489744
- Product name
- ROCK1 monoclonal antibody (M01), clone 2E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ROCK1.
- Antigen sequence
SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKL
EEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEE
GNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQE
NEKRR- Isotype
- IgG
- Antibody clone number
- 2E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel role of Rho-kinase in the regulation of ligand-induced phosphorylated EGFR endocytosis via the early/late endocytic pathway in human fibrosarcoma cells.
Integration of virtual screening with high-throughput screening for the identification of novel Rho-kinase I inhibitors.
Nishimura Y, Bereczky B, Yoshioka K, Taniguchi S, Itoh K
Journal of molecular histology 2011 Oct;42(5):427-42
Journal of molecular histology 2011 Oct;42(5):427-42
Integration of virtual screening with high-throughput screening for the identification of novel Rho-kinase I inhibitors.
Gong LL, Fang LH, Peng JH, Liu AL, Du GH
Journal of biotechnology 2010 Feb 1;145(3):295-303
Journal of biotechnology 2010 Feb 1;145(3):295-303
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ROCK1 monoclonal antibody (M01), clone 2E2 Western Blot analysis of ROCK1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ROCK1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ROCK1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
