WH0011177M1

BAZ1A antibody from MilliporeSigma / Merck KGaA
ACF1, hACF1, WALp1, WCRF180
ELISA
Recommended by provider

Antibody data

Product number
WH0011177M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0011177M1, RRID:AB_1840186
Product name
Monoclonal Anti-BAZ1A antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0011177M1
Antibody type
Monoclonal
Antigen
BAZ1A (NP_038476, a.a. 1457-1557) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLA
SEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFF
HIQAQKLGLHVTPSNVDQVSTPPAAKKSRI* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -