PAB28595

BAZ1A antibody from Abnova Corporation
ACF1, hACF1, WALp1, WCRF180

Antibody data

Product number
PAB28595
Provider
Abnova Corporation
Product name
BAZ1A polyclonal antibody
Provider product page
Abnova Corporation - PAB28595
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant BAZ1A.
Antigen sequence
RGHRESALKETLLQEKSRICAQLARFSEEKFHFSD
KPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLR
DFLLDIEDRIYQGTLGAIKVTDRHIWRSALESGRY
ELLSEENKENGIIKTVNEDVEEMEIDEQTK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -