H00011177-M01

BAZ1A antibody from Abnova Corporation
ACF1, hACF1, WALp1, WCRF180
No application information provided.

Antibody data

Product number
H00011177-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011177-M01, RRID:AB_605974
Product name
BAZ1A monoclonal antibody (M01), clone 1F6
Provider product page
Abnova Corporation - H00011177-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BAZ1A.
Antigen sequence
LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLA
SEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFF
HIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Isotype
IgG
Antibody clone number
1F6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -