ABIN486992

BAZ1A antibody from antibodies-online
ACF1, hACF1, WALp1, WCRF180

Antibody data

Product number
ABIN486992
Provider
antibodies-online
Product name
anti-Bromodomain Adjacent To Zinc Finger Domain, 1A (BAZ1A) antibody
Provider product page
antibodies-online - ABIN486992
Antibody type
Polyclonal
Antigen
The immunogen for anti-BAZ1A antibody: synthetic peptide directed towards the middle region of human BAZ1A
Reactivity
Human, Mouse, Bovine, Canine
Host
Rabbit
Antigen sequence
SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGR
YPSRS QQSTPKTTVS
Vial size
50 µg
Provider Type Product Number
- No reagents -