HPA002637

antibody from Atlas Antibodies

Targeting: CDK6 PLSTIRE

Antibody data

Submit

Validation data

Product number: HPA002637 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002637, RRID:AB_1846432
Product name: Anti-CDK6
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQA FHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKR ISAYSALSHPYFQDLERCKENLDSHLPPSQNTSEL N
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CDK6 protein structure - HPA002637 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDK6 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDK6 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines U2OS and A-549 using Anti-CDK6 antibody. Corresponding CDK6 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Sample type: MOUSE, RAT

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA002637 antibody. Corresponding CDK6 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN