Antibody data

Product number
H00001145-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001145-M01, RRID:AB_509144
Product name
CHRNE monoclonal antibody (M01), clone 6A2
Provider product page
Abnova Corporation - H00001145-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHRNE.
Antigen sequence
KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKV
TLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKD
DFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYD
ANVLV
Isotype
IgG
Antibody clone number
6A2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -