Antibody data

Product number
H00001145-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001145-M02, RRID:AB_10549295
Product name
CHRNE monoclonal antibody (M02), clone 1H5
Provider product page
Abnova Corporation - H00001145-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHRNE.
Antigen sequence
KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKV
TLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKD
DFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYD
ANVLV
Isotype
IgG
Antibody clone number
1H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -