Antibody data

Product number
ABIN184225
Provider
antibodies-online
Product name
anti-Cholinergic Receptor, Nicotinic, epsilon (Muscle) (CHRNE) (N-Term) antibody
Provider product page
antibodies-online - ABIN184225
Antibody type
Polyclonal
Antigen
The immunogen for anti-CHRNE antibody: synthetic peptide directed towards the N terminal of human CHRNE
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPED
TVTIS LKVTLTNLIS
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -