Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502439 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A11 antibody: synthetic peptide directed towards the C terminal of human SLC25A11
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYAR
LGPHT VLTFIFLEQM- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Porphyrin accumulation in mitochondria is mediated by 2-oxoglutarate carrier.
Kabe Y, Ohmori M, Shinouchi K, Tsuboi Y, Hirao S, Azuma M, Watanabe H, Okura I, Handa H
The Journal of biological chemistry 2006 Oct 20;281(42):31729-35
The Journal of biological chemistry 2006 Oct 20;281(42):31729-35
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry