Antibody data

Product number
ABIN184222
Provider
antibodies-online
Product name
anti-Cholinergic Receptor, Nicotinic, beta 3 (Neuronal) (CHRNB3) (Middle Region) antibody
Provider product page
antibodies-online - ABIN184222
Antibody type
Polyclonal
Antigen
The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK
GNRRD GVYSYPFITY
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -