Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184222 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cholinergic Receptor, Nicotinic, beta 3 (Neuronal) (CHRNB3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMK
GNRRD GVYSYPFITY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The effects of beta3 subunit incorporation on the pharmacology and single channel properties of oocyte-expressed human alpha3beta4 neuronal nicotinic receptors.
Boorman JP, Beato M, Groot-Kormelink PJ, Broadbent SD, Sivilotti LG
The Journal of biological chemistry 2003 Nov 7;278(45):44033-40
The Journal of biological chemistry 2003 Nov 7;278(45):44033-40
No comments: Submit comment
No validations: Submit validation data