AV13021

CHRNB3 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
AV13021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV13021, RRID:AB_1854477
Product name
Anti-CHRNB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV13021
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CHRNB3 with an internal ID of P01335
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVDLILINENVDRKDFFDNGEWEILNAKGMKGNRR
DGVYSYPFITYSFVL
Storage
-20C
Provider Type Product Number
- No reagents -