HPA021186

antibody from Atlas Antibodies

Targeting: OBSCN ARHGEF30, KIAA1556, KIAA1639, UNC89

Antibody data

Submit

Validation data

Product number: HPA021186 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021186, RRID:AB_1854761
Product name: Anti-OBSCN
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ACVVVSGSESEAESSSGGELDDAFRRAARRLHRLF RTKSPAEVSDEELFLSADEGPAEPEEPADWQTYRE DEHFICIRFEALTEARQAVTRFQEMFATLGIGVEI KLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSD AAP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

OBSCN protein structure - HPA021186 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA021186 antibody. Corresponding OBSCN RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Sample type: HUMAN