HPA048515

antibody from Atlas Antibodies

Targeting: CLEC12A CD371, CLL-1, DCAL-2, MICL

Antibody data

Submit

Validation data

Product number: HPA048515 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048515, RRID:AB_2680425
Product name: Anti-CLEC12A
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKD SCYFLSDDVQTWQESKMACAAQNASLLKINNKNAL EFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSS AWVIRNAPD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CLEC12A protein structure - HPA048515 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA048515 antibody. Corresponding CLEC12A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in granulocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in granulocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymphoid tissues shows moderate membranous positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows strong positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN