Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002079-M14 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002079-M14, RRID:AB_622311
- Product name
- ERH monoclonal antibody (M14), clone 4A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ERH.
- Antigen sequence
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKM
YEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL
VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK- Isotype
- IgG
- Antibody clone number
- 4A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ERH expression in transfected 293T cell line by ERH monoclonal antibody (M14), clone 4A10.Lane 1: ERH transfected lysate(12.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ERH is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ERH on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ERH on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
