Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405780 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Neutrophil Cytosolic Factor 4, 40kDa (NCF4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the middle region of human NCF4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTIS
TIKSV AWEGGACPAF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of a mutation in the Phox homology domain of the NADPH oxidase component p40phox identifies a mechanism for negative regulation of superoxide production.
Chen J, He R, Minshall RD, Dinauer MC, Ye RD
The Journal of biological chemistry 2007 Oct 12;282(41):30273-84
The Journal of biological chemistry 2007 Oct 12;282(41):30273-84
No comments: Submit comment
No validations: Submit validation data