HPA030609

antibody from Atlas Antibodies

Targeting: ITGA9 ALPHA-RLC, ITGA4L, RLC

Antibody data

Submit

Validation data

Product number: HPA030609 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030609, RRID:AB_10600815
Product name: Anti-ITGA9
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTT CFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVY FVLLGETMGQVTEKLQLTYMEETCRHYVAHVK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ITGA9 protein structure - HPA030609 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cervix, uterine and skeletal muscle tissues using HPA030609 antibody. Corresponding ITGA9 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Sample type: HUMAN