PAB20123

PPP4R3A antibody from Abnova Corporation
FLFL1, FLJ20707, KIAA2010, MSTP033, PP4R3, SMEK1, smk-1, smk1

Antibody data

Product number
PAB20123
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20123, RRID:AB_10961894
Product name
SMEK1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20123
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SMEK1.
Antigen sequence
DGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESE
EKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSS
TTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITT
KGGLVGLVDYPDDDEDDDEDEDK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -