H00007291-M13
antibody from Abnova Corporation
Targeting: TWIST1
ACS3, bHLHa38, BPES2, BPES3, CRS, CRS1, H-twist, SCS, TWIST
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007291-M13 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007291-M13, RRID:AB_894319
- Product name
- TWIST1 monoclonal antibody (M13), clone 2G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TWIST1.
- Antigen sequence
LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPS
DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS- Isotype
- IgG
- Antibody clone number
- 2G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Deregulation of TWIST-1 in the CD34+ compartment represents a novel prognostic factor in chronic myeloid leukemia.
Cosset E, Hamdan G, Jeanpierre S, Voeltzel T, Sagorny K, Hayette S, Mahon FX, Dumontet C, Puisieux A, Nicolini FE, Maguer-Satta V
Blood 2011 Feb 3;117(5):1673-6
Blood 2011 Feb 3;117(5):1673-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TWIST1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol