Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002874-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002874-M01, RRID:AB_463967
- Product name
- GPS2 monoclonal antibody (M01), clone 3C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GPS2.
- Antigen sequence
QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQ
TGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQP
AGKSGFAATSQPGPRLPFIQHSQNPRFYHK- Isotype
- IgG
- Antibody clone number
- 3C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis.
Sanyal S, Båvner A, Haroniti A, Nilsson LM, Lundåsen T, Rehnmark S, Witt MR, Einarsson C, Talianidis I, Gustafsson JA, Treuter E
Proceedings of the National Academy of Sciences of the United States of America 2007 Oct 2;104(40):15665-70
Proceedings of the National Academy of Sciences of the United States of America 2007 Oct 2;104(40):15665-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 monoclonal antibody (M01), clone 3C4.Lane 1: GPS2 transfected lysate (Predicted MW: 36.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GPS2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
