Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA020081 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA020081, RRID:AB_1844386
- Product name
- Anti-MACC1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DSSGDELDVHQLLRQTSSRNSGRSKSVSELLDILD
DTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWL
SQRQLARSCLDLNTISQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Impact of MACC1 on human malignant glioma progression and patients' unfavorable prognosis.
Hagemann C, Fuchs S, Monoranu CM, Herrmann P, Smith J, Hohmann T, Grabiec U, Kessler AF, Dehghani F, Löhr M, Ernestus RI, Vince GH, Stein U
Neuro-oncology 2013 Dec;15(12):1696-709
Neuro-oncology 2013 Dec;15(12):1696-709
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell line A-431 and human cell line HeLa.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.