HPA018107

antibody from Atlas Antibodies

Targeting: SLC12A1 NKCC2

Antibody data

Submit

Validation data

Product number: HPA018107 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018107, RRID:AB_1854504
Product name: Anti-SLC12A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SQGFDISQVLQVQEELERLEQERLALEATIKDNEC EEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQS MHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC12A1 protein structure - HPA018107 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC12A1 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and lymph node using Anti-SLC12A1 antibody HPA018107 (A) shows similar protein distribution across tissues to independent antibody HPA014967 (B).
Antibody #2 product nr: HPA014967
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong membranous positivity in cells of distal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SLC12A1 antibody HPA018107.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-SLC12A1 antibody HPA018107.
Sample type: HUMAN